Recombinant Human GADD45GIP1, His-tagged

• Cat.No.: GADD45GIP1-26074TH
• Product Overview: Recombinant fragment of Human GADD45GIP1 with a N terminal His tag; 196 amino acids with a predicted MWt 22.6 kDa including tag.

Specification

• Description: GADD45GIP1, also known as CRIF1, is a nuclear protein that plays a role in apoptosis control. This protein is expressed in a variety of tissues, including heart, thyroid, trachea, kidney, ovary, pancreas, testis and stomach.
• Protein length: 175 amino acids
• Conjugation: HIS
• Molecular Weight: 22.600kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary th
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.03% DTT, 1.17% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPRWQLGPRYAAKQFARYGA ASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVK QLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKA QADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKE RKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS

Gene Information

• Gene Name: GADD45GIP1 growth arrest and DNA-damage-inducible, gamma interacting protein 1 [ Homo sapiens ]
• Official Symbol: GADD45GIP1
• Synonyms: GADD45GIP1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; growth arrest and DNA damage-inducible proteins-interacting protein 1; CKBBP2; CKII beta binding protein 2; CR6 interacting factor 1; CRIF1; MGC4667; MGC4758; p53 responsive
• Gene ID: 90480
• mRNA Refseq: NM_052850
• Protein Refseq: NP_443082
• MIM: 605162
• Uniprot ID: Q8TAE8
• Chromosome Location: 19p13.2
• Function: protein binding