"GADD45GIP1" Related Products

Expand

Recombinant Human GADD45GIP1, His-tagged

Cat.No.: GADD45GIP1-26074TH
Product Overview: Recombinant fragment of Human GADD45GIP1 with a N terminal His tag; 196 amino acids with a predicted MWt 22.6 kDa including tag.
Description: GADD45GIP1, also known as CRIF1, is a nuclear protein that plays a role in apoptosis control. This protein is expressed in a variety of tissues, including heart, thyroid, trachea, kidney, ovary, pancreas, testis and stomach.
Protein length: 175 amino acids
Conjugation: HIS
Molecular Weight: 22.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary th
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.03% DTT, 1.17% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPRWQLGPRYAAKQFARYGA ASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVK QLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKA QADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKE RKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Gene Name: GADD45GIP1 growth arrest and DNA-damage-inducible, gamma interacting protein 1 [ Homo sapiens ]
Official Symbol: GADD45GIP1
Synonyms: GADD45GIP1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; growth arrest and DNA damage-inducible proteins-interacting protein 1; CKBBP2; CKII beta binding protein 2; CR6 interacting factor 1; CRIF1; MGC4667; MGC4758; p53 responsive
Gene ID: 90480
mRNA Refseq: NM_052850
Protein Refseq: NP_443082
MIM: 605162
Uniprot ID: Q8TAE8
Chromosome Location: 19p13.2
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.