Recombinant Full Length Human GADD45GIP1 Protein, GST-tagged

Cat.No. : GADD45GIP1-5209HF
Product Overview : Human GADD45GIP1 full-length ORF ( NP_443082.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 222 amino acids
Description : This gene encodes a nuclear-localized protein that may be induced by p53 and regulates the cell cycle by inhibiting G1 to S phase progression. The encoded protein may interact with other cell cycle regulators. [provided by RefSeq, Aug 2012]
Molecular Mass : 51.8 kDa
AA Sequence : MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GADD45GIP1 growth arrest and DNA-damage-inducible, gamma interacting protein 1 [ Homo sapiens ]
Official Symbol GADD45GIP1
Synonyms GADD45GIP1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; growth arrest and DNA damage-inducible proteins-interacting protein 1; CKBBP2; CKII beta binding protein 2; CR6 interacting factor 1; CRIF1; MGC4667; MGC4758; p53 responsive gene 6; papillomavirus L2 interacting nuclear protein 1; PLINP 1; Plinp1; PRG6; CR6-interacting factor 1; CKII beta-associating protein; p53-responsive gene 6 protein; papillomavirus L2-interacting nuclear protein 1; PLINP-1;
Gene ID 90480
mRNA Refseq NM_052850
Protein Refseq NP_443082
MIM 605162
UniProt ID Q8TAE8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GADD45GIP1 Products

Required fields are marked with *

My Review for All GADD45GIP1 Products

Required fields are marked with *

0
cart-icon