Recombinant Human GATA2
Cat.No. : | GATA2-28983TH |
Product Overview : | Recombinant fragment of Human GATA2 with N terminal proprietary tag, 36.85kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants. |
Protein length : | 102 amino acids |
Molecular Weight : | 36.850kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Endothelial cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLL PPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLT GGQMCRPHLLHSPGLPWLDGGK |
Sequence Similarities : | Contains 2 GATA-type zinc fingers. |
Gene Name : | GATA2 GATA binding protein 2 [ Homo sapiens ] |
Official Symbol : | GATA2 |
Synonyms : | GATA2; GATA binding protein 2; endothelial transcription factor GATA-2; NFE1B; |
Gene ID : | 2624 |
mRNA Refseq : | NM_001145661 |
Protein Refseq : | NP_001139133 |
MIM : | 137295 |
Uniprot ID : | P23769 |
Chromosome Location : | 3q21 |
Pathway : | Adipogenesis, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; |
Function : | C2H2 zinc finger domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding; |
Products Types
◆ Recombinant Protein | ||
GATA2-962H | Recombinant Human GATA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gata2-3160M | Recombinant Mouse Gata2 Protein, Myc/DDK-tagged | +Inquiry |
GATA2-3482M | Recombinant Mouse GATA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GATA2-4745H | Recombinant Human GATA2 Protein, GST-tagged | +Inquiry |
GATA2-2792H | Recombinant Human GATA2 Protein (Pro175-Gly480), His tagged | +Inquiry |
◆ Lysates | ||
GATA2-6013HCL | Recombinant Human GATA2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket