Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human GATA2

Cat.No. : GATA2-28983TH
Product Overview : Recombinant fragment of Human GATA2 with N terminal proprietary tag, 36.85kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.
Protein length : 102 amino acids
Molecular Weight : 36.850kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Endothelial cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLL PPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLT GGQMCRPHLLHSPGLPWLDGGK
Sequence Similarities : Contains 2 GATA-type zinc fingers.
Gene Name : GATA2 GATA binding protein 2 [ Homo sapiens ]
Official Symbol : GATA2
Synonyms : GATA2; GATA binding protein 2; endothelial transcription factor GATA-2; NFE1B;
Gene ID : 2624
mRNA Refseq : NM_001145661
Protein Refseq : NP_001139133
MIM : 137295
Uniprot ID : P23769
Chromosome Location : 3q21
Pathway : Adipogenesis, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem;
Function : C2H2 zinc finger domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends