Recombinant Human GFER GFER-27232TH

Recombinant Human GFER

PRODUCTS

Home / Products / Recombinant Human GFER

Recombinant Human GFER

GFER Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GFER-27232TH
Product Overview : Recombinant full length Human ALR isoform 2 with N-terminal proprietary tag.Mol Wt 39.86 kDa inclusive of tag.
Description : The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
Protein length : 125 amino acids
Molecular Weight : 39.860kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDT RTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWK DGSCD
Sequence Similarities : Contains 1 ERV/ALR sulfhydryl oxidase domain.
Gene Name : GFER growth factor, augmenter of liver regeneration [ Homo sapiens ]
Official Symbol : GFER
Synonyms : GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS;
Gene ID : 2671
mRNA Refseq : NM_005262
Protein Refseq : NP_005253
MIM : 600924
Uniprot ID : P55789
Chromosome Location : 16p13.3-p13.12
Function : growth factor activity; oxidoreductase activity; protein binding; thiol oxidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy