Recombinant Human GFER
Cat.No. : | GFER-27232TH |
Product Overview : | Recombinant full length Human ALR isoform 2 with N-terminal proprietary tag.Mol Wt 39.86 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. |
Protein length : | 125 amino acids |
Molecular Weight : | 39.860kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDT RTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWK DGSCD |
Sequence Similarities : | Contains 1 ERV/ALR sulfhydryl oxidase domain. |
Gene Name : | GFER growth factor, augmenter of liver regeneration [ Homo sapiens ] |
Official Symbol : | GFER |
Synonyms : | GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS; |
Gene ID : | 2671 |
mRNA Refseq : | NM_005262 |
Protein Refseq : | NP_005253 |
MIM : | 600924 |
Uniprot ID : | P55789 |
Chromosome Location : | 16p13.3-p13.12 |
Function : | growth factor activity; oxidoreductase activity; protein binding; thiol oxidase activity; |
Products Types
◆ Recombinant Protein | ||
GFER-4849H | Recombinant Human GFER Protein, GST-tagged | +Inquiry |
GFER-1225R | Recombinant Rat GFER Protein, His-SUMO-tagged | +Inquiry |
GFER-2165R | Recombinant Rat GFER Protein, His (Fc)-Avi-tagged | +Inquiry |
GFER-491H | Recombinant Human GFER Protein | +Inquiry |
GFER-3342H | Recombinant Human GFER protein(Met1-Asp125), His-tagged | +Inquiry |
◆ Lysates | ||
GFER-5954HCL | Recombinant Human GFER 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket