Recombinant Human GK
| Cat.No. : | GK-29028TH |
| Product Overview : | Recombinant fragment of Human Glycerol kinase (aa 2-94) with a N terminal proprietary tag: predicted molecular weight 35.86 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 93 amino acids |
| Description : | The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 35.860kDa inclusive of tags |
| Tissue specificity : | Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR |
| Sequence Similarities : | Belongs to the FGGY kinase family. |
| Gene Name | GK glycerol kinase [ Homo sapiens ] |
| Official Symbol | GK |
| Synonyms | GK; glycerol kinase; GK1; GKD; |
| Gene ID | 2710 |
| mRNA Refseq | NM_000167 |
| Protein Refseq | NP_000158 |
| MIM | 300474 |
| Uniprot ID | P32189 |
| Chromosome Location | Xp21.3 |
| Pathway | Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | ATP binding; glycerol kinase activity; glycerol kinase activity; nucleotide binding; transferase activity; |
| ◆ Native Proteins | ||
| GK-01B | Active Recombinant Bacillus Stearothermo Glycerol Kinase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GK-5913HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
| GK-5914HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GK Products
Required fields are marked with *
My Review for All GK Products
Required fields are marked with *
