"GK" Related Products

Expand

Recombinant Human GK

Cat.No.: GK-29028TH
Product Overview: Recombinant fragment of Human Glycerol kinase (aa 2-94) with a N terminal proprietary tag: predicted molecular weight 35.86 kDa.
Description: The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 93 amino acids
Molecular Weight: 35.860kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR
Sequence Similarities: Belongs to the FGGY kinase family.
Gene Name: GK glycerol kinase [ Homo sapiens ]
Official Symbol: GK
Synonyms: GK; glycerol kinase; GK1; GKD;
Gene ID: 2710
mRNA Refseq: NM_000167
Protein Refseq: NP_000158
MIM: 300474
Uniprot ID: P32189
Chromosome Location: Xp21.3
Pathway: Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: ATP binding; glycerol kinase activity; glycerol kinase activity; nucleotide binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.