Recombinant Human HOXA5

Cat.No. : HOXA5-29376TH
Product Overview : Recombinant fragment of Human HOXA5 with a N terminal proprietary tag: Predicted molecular weight 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSD
Sequence Similarities : Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXA5 homeobox A5 [ Homo sapiens ]
Official Symbol HOXA5
Synonyms HOXA5; homeobox A5; homeo box A5 , HOX1, HOX1C; homeobox protein Hox-A5;
Gene ID 3202
mRNA Refseq NM_019102
Protein Refseq NP_061975
MIM 142952
Uniprot ID P20719
Chromosome Location 7p15.2
Function DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA5 Products

Required fields are marked with *

My Review for All HOXA5 Products

Required fields are marked with *

0
cart-icon