Recombinant Human HOXA5
Cat.No. : | HOXA5-29376TH |
Product Overview : | Recombinant fragment of Human HOXA5 with a N terminal proprietary tag: Predicted molecular weight 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSD |
Sequence Similarities : | Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXA5 homeobox A5 [ Homo sapiens ] |
Official Symbol | HOXA5 |
Synonyms | HOXA5; homeobox A5; homeo box A5 , HOX1, HOX1C; homeobox protein Hox-A5; |
Gene ID | 3202 |
mRNA Refseq | NM_019102 |
Protein Refseq | NP_061975 |
MIM | 142952 |
Uniprot ID | P20719 |
Chromosome Location | 7p15.2 |
Function | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HOXA5-01H | Recombinant Human HOXA5 Protein, His-tagged | +Inquiry |
HOXA5-29376TH | Recombinant Human HOXA5 | +Inquiry |
HOXA5-4281M | Recombinant Mouse HOXA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA5-4946H | Recombinant Human HOXA5 Protein, GST-tagged | +Inquiry |
HOXA5-301240H | Recombinant Human HOXA5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA5-5425HCL | Recombinant Human HOXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA5 Products
Required fields are marked with *
My Review for All HOXA5 Products
Required fields are marked with *
0
Inquiry Basket