Recombinant Human HSD17B14, His-tagged

Cat.No. : HSD17B14-28397TH
Product Overview : Recombinant full length Human HSD17B14 protein with an N terminal His tag ; Predicted MWt: 32.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 270 amino acids
Description : 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al.
Conjugation : HIS
Molecular Weight : 32.400kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
Gene Name HSD17B14 hydroxysteroid (17-beta) dehydrogenase 14 [ Homo sapiens ]
Official Symbol HSD17B14
Synonyms HSD17B14; hydroxysteroid (17-beta) dehydrogenase 14; dehydrogenase/reductase (SDR family) member 10 , DHRS10; 17-beta-hydroxysteroid dehydrogenase 14; retinal short chain dehydrogenase/reductase 3; retSDR3; SDR47C1; short chain dehydrogenase/reductase fam
Gene ID 51171
mRNA Refseq NM_016246
Protein Refseq NP_057330
MIM 612832
Uniprot ID Q9BPX1
Chromosome Location 19q13.33
Function estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity; protein binding; testosterone 17-beta-dehydrogenase (NADP+) activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B14 Products

Required fields are marked with *

My Review for All HSD17B14 Products

Required fields are marked with *

0
cart-icon
0
compare icon