Recombinant Human HSD17B14 Protein, GST-tagged

Cat.No. : HSD17B14-5068H
Product Overview : Human HSD17B14 full-length ORF ( NP_057330.2, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM
Molecular Mass : 54.7 kDa
AA Sequence : MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSD17B14 hydroxysteroid (17-beta) dehydrogenase 14 [ Homo sapiens ]
Official Symbol HSD17B14
Synonyms HSD17B14; hydroxysteroid (17-beta) dehydrogenase 14; dehydrogenase/reductase (SDR family) member 10 , DHRS10; 17-beta-hydroxysteroid dehydrogenase 14; retinal short chain dehydrogenase/reductase 3; retSDR3; SDR47C1; short chain dehydrogenase/reductase family 47C; member 1; 17-beta-HSD 14; 17-beta-hydroxysteroid dehydrogenase DHRS10; dehydrogenase/reductase SDR family member 10; retinal short-chain dehydrogenase/reductase 3; dehydrogenase/reductase (SDR family) member 10; retinal short-chain dehydrogenase/reductase retSDR3; short chain dehydrogenase/reductase family 47C, member 1; DHRS10;
Gene ID 51171
mRNA Refseq NM_016246
Protein Refseq NP_057330
MIM 612832
UniProt ID Q9BPX1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B14 Products

Required fields are marked with *

My Review for All HSD17B14 Products

Required fields are marked with *

0
cart-icon