Recombinant Human HSD3B2
Cat.No. : | HSD3B2-29343TH |
Product Overview : | Recombinant full length Human HSD3B2 (aa 1-372) with N-terminal proprietary tag, 66.99 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. |
Protein length : | 372 amino acids |
Molecular Weight : | 66.990kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in adrenal gland, testis and ovary. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRP ELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIH TACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI YTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKL AEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSAS INEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR DPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLD SRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVT LSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV DRHKETLKSKTQ |
Sequence Similarities : | Belongs to the 3-beta-HSD family. |
Gene Name : | HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ] |
Official Symbol : | HSD3B2 |
Synonyms : | HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2; |
Gene ID : | 3284 |
mRNA Refseq : | NM_000198 |
Protein Refseq : | NP_000189 |
MIM : | 613890 |
Uniprot ID : | P26439 |
Chromosome Location : | 1p12 |
Pathway : | Androgen biosynthesis, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => |
Function : | 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; isomerase activity; nucleotide binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
HSD3B2-002H | Recombinant Human HSD3B2 Protein, Myc/DDK-tagged | +Inquiry |
HSD3B2-5079H | Recombinant Human HSD3B2 Protein, GST-tagged | +Inquiry |
HSD3B2-1111H | Recombinant Human HSD3B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD3B2-001H | Recombinant Human HSD3B2 Protein, Myc/DDK-tagged | +Inquiry |
HSD3B2-4340M | Recombinant Mouse HSD3B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket