"HSD3B2" Related Products

Recombinant Human HSD3B2

Cat.No.: HSD3B2-29343TH
Product Overview: Recombinant full length Human HSD3B2 (aa 1-372) with N-terminal proprietary tag, 66.99 kDa.
Description: The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene.
Protein length: 372 amino acids
Molecular Weight: 66.990kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in adrenal gland, testis and ovary.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRP ELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIH TACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI YTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKL AEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSAS INEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR DPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLD SRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVT LSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV DRHKETLKSKTQ
Sequence Similarities: Belongs to the 3-beta-HSD family.
Gene Name: HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ]
Official Symbol: HSD3B2
Synonyms: HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2;
Gene ID: 3284
mRNA Refseq: NM_000198
Protein Refseq: NP_000189
MIM: 613890
Uniprot ID: P26439
Chromosome Location: 1p12
Pathway: Androgen biosynthesis, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone =>
Function: 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; isomerase activity; nucleotide binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.