Recombinant Human HSD3B2 protein, His-tagged
| Cat.No. : | HSD3B2-3417H | 
| Product Overview : | Recombinant Human HSD3B2 protein(1-286 aa), fused to His tag, was expressed in E. coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-286 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AA Sequence : | MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ] | 
| Official Symbol | HSD3B2 | 
| Synonyms | HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5--> 4-isomerase type 2; 3-beta-HSD II; 3 beta-HSD type II; progesterone reductase; delta 5-delta 4-isomerase type II; 3-beta-HSD adrenal and gonadal type; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; short chain dehydrogenase/reductase family 11E, member 2; 4-isomerase type II; 3 beta-hydroxysteroid dehydrogenase type II, delta 5-delta 4-isomerase type II, 3 beta-HSD type II; HSDB; HSD3B; | 
| Gene ID | 3284 | 
| mRNA Refseq | NM_000198 | 
| Protein Refseq | NP_000189 | 
| MIM | 613890 | 
| UniProt ID | P26439 | 
| ◆ Recombinant Proteins | ||
| HSD3B2-246HF | Recombinant Full Length Human HSD3B2 Protein | +Inquiry | 
| HSD3B2-7883M | Recombinant Mouse HSD3B2 Protein | +Inquiry | 
| HSD3B2-5079H | Recombinant Human HSD3B2 Protein, GST-tagged | +Inquiry | 
| RFL1053HF | Recombinant Full Length Human 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 2(Hsd3B2) Protein, His-Tagged | +Inquiry | 
| HSD3B2-6675C | Recombinant Chicken HSD3B2 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD3B2 Products
Required fields are marked with *
My Review for All HSD3B2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            