"IL13RA2" Related Products

Expand
Expand

Recombinant Human IL13RA2

Cat.No.: IL13RA2-28498TH
Product Overview: Recombinant fragment of Human IL13 receptor alpha 2 with N terminal proprietary tag, 36.63kDa.
Description: The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
Sequence Similarities: Belongs to the type I cytokine receptor family. Type 5 subfamily.Contains 1 fibronectin type-III domain.
Gene Name: IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ]
Official Symbol: IL13RA2
Synonyms: IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP;
Gene ID: 3598
mRNA Refseq: NM_000640
Protein Refseq: NP_000631
MIM: 300130
Uniprot ID: Q14627
Chromosome Location: Xq13.1-q28
Pathway: IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.