Recombinant Human IL13RA2

Cat.No. : IL13RA2-28498TH
Product Overview : Recombinant fragment of Human IL13 receptor alpha 2 with N terminal proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
Sequence Similarities : Belongs to the type I cytokine receptor family. Type 5 subfamily.Contains 1 fibronectin type-III domain.
Gene Name IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ]
Official Symbol IL13RA2
Synonyms IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP;
Gene ID 3598
mRNA Refseq NM_000640
Protein Refseq NP_000631
MIM 300130
Uniprot ID Q14627
Chromosome Location Xq13.1-q28
Pathway IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function cytokine receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL13RA2 Products

Required fields are marked with *

My Review for All IL13RA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon