Recombinant Human ILF2, His-tagged
Cat.No. : | ILF2-29033TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 25-390 of Human ILF2 with an N terminal His tag; Predicted MWt 41kDa. |
Availability | September 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-390 a.a. |
Description : | Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDL APNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEV RQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILIT TVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNN PTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESG NFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQ EGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEE EENTEEPPQGEEEESMETQE |
Sequence Similarities : | Contains 1 DZF domain. |
Gene Name | ILF2 interleukin enhancer binding factor 2, 45kDa [ Homo sapiens ] |
Official Symbol | ILF2 |
Synonyms | ILF2; interleukin enhancer binding factor 2, 45kDa; interleukin enhancer binding factor 2, 45kD; interleukin enhancer-binding factor 2; NF45; |
Gene ID | 3608 |
mRNA Refseq | NM_004515 |
Protein Refseq | NP_004506 |
MIM | 603181 |
Uniprot ID | Q12905 |
Chromosome Location | 1q21.3 |
Function | ATP binding; DNA binding; double-stranded RNA binding; protein binding; transferase activity; |
◆ Recombinant Proteins | ||
ILF2-5162H | Recombinant Human ILF2 Protein, GST-tagged | +Inquiry |
ILF2-12438Z | Recombinant Zebrafish ILF2 | +Inquiry |
ILF2-29033TH | Recombinant Human ILF2, His-tagged | +Inquiry |
Ilf2-3524M | Recombinant Mouse Ilf2 Protein, Myc/DDK-tagged | +Inquiry |
ILF2-3050R | Recombinant Rat ILF2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILF2-5222HCL | Recombinant Human ILF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ILF2 Products
Required fields are marked with *
My Review for All ILF2 Products
Required fields are marked with *