"ILF2" Related Products

Expand
Expand

Recombinant Human ILF2, His-tagged

Cat.No.: ILF2-29033TH
Product Overview: Recombinant fragment, corresponding to amino acids 25-390 of Human ILF2 with an N terminal His tag; Predicted MWt 41kDa.
Description: Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 108 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDL APNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEV RQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILIT TVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNN PTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESG NFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQ EGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEE EENTEEPPQGEEEESMETQE
Sequence Similarities: Contains 1 DZF domain.
Gene Name: ILF2 interleukin enhancer binding factor 2, 45kDa [ Homo sapiens ]
Official Symbol: ILF2
Synonyms: ILF2; interleukin enhancer binding factor 2, 45kDa; interleukin enhancer binding factor 2, 45kD; interleukin enhancer-binding factor 2; NF45;
Gene ID: 3608
mRNA Refseq: NM_004515
Protein Refseq: NP_004506
MIM: 603181
Uniprot ID: Q12905
Chromosome Location: 1q21.3
Function: ATP binding; DNA binding; double-stranded RNA binding; protein binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.