Recombinant Full Length Human ILF2 Protein, C-Flag-tagged
Cat.No. : | ILF2-2050HFL |
Product Overview : | Recombinant Full Length Human ILF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.9 kDa |
AA Sequence : | MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAE QASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARW FEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF LPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | ILF2 interleukin enhancer binding factor 2 [ Homo sapiens (human) ] |
Official Symbol | ILF2 |
Synonyms | NF45; PRO3063 |
Gene ID | 3608 |
mRNA Refseq | NM_004515.4 |
Protein Refseq | NP_004506.2 |
MIM | 603181 |
UniProt ID | Q12905 |
◆ Recombinant Proteins | ||
ILF2-2050HFL | Recombinant Full Length Human ILF2 Protein, C-Flag-tagged | +Inquiry |
ILF2-4523M | Recombinant Mouse ILF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ILF2-3050R | Recombinant Rat ILF2 Protein | +Inquiry |
ILF2-1181H | Recombinant Human ILF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ILF2-12438Z | Recombinant Zebrafish ILF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILF2-5222HCL | Recombinant Human ILF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ILF2 Products
Required fields are marked with *
My Review for All ILF2 Products
Required fields are marked with *
0
Inquiry Basket