Recombinant Human ING1

• Cat.No.: ING1-28775TH
• Product Overview: Recombinant full length Human ING1, isoform 2 with a N terminal proprietary tag: Predicted MW 56.76 kDa.

Specification

• Description: This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Protein length: 279 amino acids
• Molecular Weight: 56.760kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expressed in breast and c
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREI DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIR SQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELG DTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRE NASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASP ADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
• Sequence Similarities: Belongs to the ING family.Contains 1 PHD-type zinc finger.

Gene Information

• Gene Name: ING1 inhibitor of growth family, member 1 [ Homo sapiens ]
• Official Symbol: ING1
• Synonyms: ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1
• Gene ID: 3621
• mRNA Refseq: NM_198217
• Protein Refseq: NP_937860
• MIM: 601566
• Uniprot ID: Q9UK53
• Chromosome Location: 13q34
• Pathway: Senescence and Autophagy, organism-specific biosystem
• Function: metal ion binding; methylated histone residue binding; zinc ion binding