Recombinant Full Length Human ING1 Protein

• Cat.No.: ING1-256HF
• Product Overview: Recombinant full length Human ING1, isoform 2 with a N terminal proprietary tag: Predicted MW 56.76 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 279 amino acids
• Description: This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Form: Liquid
• Molecular Mass: 56.760kDa inclusive of tags
• AA Sequence: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREI DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIR SQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELG DTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRE NASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASP ADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: ING1 inhibitor of growth family, member 1 [ Homo sapiens ]
• Official Symbol: ING1
• Synonyms: ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1
• Gene ID: 3621
• mRNA Refseq: NM_198217
• Protein Refseq: NP_937860
• MIM: 601566
• UniProt ID: Q9UK53