Recombinant Full Length Human ING1 Protein
Cat.No. : | ING1-256HF |
Product Overview : | Recombinant full length Human ING1, isoform 2 with a N terminal proprietary tag: Predicted MW 56.76 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 279 amino acids |
Description : | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Form : | Liquid |
Molecular Mass : | 56.760kDa inclusive of tags |
AA Sequence : | MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREI DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIR SQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELG DTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRE NASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASP ADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | ING1 inhibitor of growth family, member 1 [ Homo sapiens ] |
Official Symbol | ING1 |
Synonyms | ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1 |
Gene ID | 3621 |
mRNA Refseq | NM_198217 |
Protein Refseq | NP_937860 |
MIM | 601566 |
UniProt ID | Q9UK53 |
◆ Recombinant Proteins | ||
ING1-4542M | Recombinant Mouse ING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ING1-668H | Recombinant Human inhibitor of growth family, member 1, His-tagged | +Inquiry |
ING1-1480H | Recombinant Human Inhibitor Of Growth Family, Member 1, His-tagged | +Inquiry |
ING1-5873HF | Recombinant Full Length Human ING1 Protein, GST-tagged | +Inquiry |
Ing1-3535M | Recombinant Mouse Ing1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ING1-001H | Recombinant Human ING1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ING1-860HCL | Recombinant Human ING1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ING1 Products
Required fields are marked with *
My Review for All ING1 Products
Required fields are marked with *