"KAL1" Related Products

Expand

Recombinant Human KAL1

Cat.No.: KAL1-29684TH
Product Overview: Recombinant fragment of Human KAL1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa.
Description: Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQV TWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPS TLYRLEVQVLTPGGEGPATIKTFRTPELPP
Sequence Similarities: Contains 4 fibronectin type-III domains.Contains 1 WAP domain.
Gene Name: KAL1 Kallmann syndrome 1 sequence [ Homo sapiens ]
Official Symbol: KAL1
Synonyms: KAL1; Kallmann syndrome 1 sequence; ADMLX, KAL; anosmin-1; anosmin 1; KALIG 1;
Gene ID: 3730
mRNA Refseq: NM_000216
Protein Refseq: NP_000207
MIM: 300836
Uniprot ID: P23352
Chromosome Location: Xp22.32
Function: extracellular matrix structural constituent; heparin binding; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.