Recombinant Human KAL1
Cat.No. : | KAL1-29684TH |
Product Overview : | Recombinant fragment of Human KAL1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQV TWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPS TLYRLEVQVLTPGGEGPATIKTFRTPELPP |
Sequence Similarities : | Contains 4 fibronectin type-III domains.Contains 1 WAP domain. |
Gene Name | KAL1 Kallmann syndrome 1 sequence [ Homo sapiens ] |
Official Symbol | KAL1 |
Synonyms | KAL1; Kallmann syndrome 1 sequence; ADMLX, KAL; anosmin-1; anosmin 1; KALIG 1; |
Gene ID | 3730 |
mRNA Refseq | NM_000216 |
Protein Refseq | NP_000207 |
MIM | 300836 |
Uniprot ID | P23352 |
Chromosome Location | Xp22.32 |
Function | extracellular matrix structural constituent; heparin binding; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
KAL1-563H | Recombinant Human KAL1 protein, His-tagged | +Inquiry |
KAL1-29684TH | Recombinant Human KAL1 | +Inquiry |
KAL1-6975C | Recombinant Chicken KAL1 | +Inquiry |
KAL1-5256H | Recombinant Human KAL1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KAL1-5093HCL | Recombinant Human KAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KAL1 Products
Required fields are marked with *
My Review for All KAL1 Products
Required fields are marked with *