Recombinant Human KAL1

• Cat.No.: KAL1-29684TH
• Product Overview: Recombinant fragment of Human KAL1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQV TWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPS TLYRLEVQVLTPGGEGPATIKTFRTPELPP
• Sequence Similarities: Contains 4 fibronectin type-III domains.Contains 1 WAP domain.

Gene Information

• Gene Name: KAL1 Kallmann syndrome 1 sequence [ Homo sapiens ]
• Official Symbol: KAL1
• Synonyms: KAL1; Kallmann syndrome 1 sequence; ADMLX, KAL; anosmin-1; anosmin 1; KALIG 1
• Gene ID: 3730
• mRNA Refseq: NM_000216
• Protein Refseq: NP_000207
• MIM: 300836
• Uniprot ID: P23352
• Chromosome Location: Xp22.32
• Function: extracellular matrix structural constituent; heparin binding; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity