Recombinant Human KCNJ10
Cat.No. : | KCNJ10-29899TH |
Product Overview : | Recombinant fragment of Human Kir4.1 with N terminal proprietary tag; predicted MWt: 37.07 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. |
Protein length : | 104 amino acids |
Molecular Weight : | 37.070kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAI SLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKL KLEESLREQAEKEGSALSVRISNV |
Sequence Similarities : | Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ10 subfamily. |
Gene Name : | KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ] |
Official Symbol : | KCNJ10 |
Synonyms : | KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1; |
Gene ID : | 3766 |
mRNA Refseq : | NM_002241 |
Protein Refseq : | NP_002232 |
MIM : | 602208 |
Uniprot ID : | P78508 |
Chromosome Location : | 1q23.2 |
Pathway : | Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; |
Function : | ATP binding; ATP-activated inward rectifier potassium channel activity; identical protein binding; nucleotide binding; potassium channel activity; |
Products Types
◆ Recombinant Protein | ||
KCNJ10-2809H | Recombinant Human KCNJ10 protein(231-370 aa), C-His-tagged | +Inquiry |
KCNJ10-2178R | Recombinant Rhesus Macaque KCNJ10 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNJ10-2851R | Recombinant Rat KCNJ10 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNJ10-2357R | Recombinant Rhesus monkey KCNJ10 Protein, His-tagged | +Inquiry |
KCNJ10-3195R | Recombinant Rat KCNJ10 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket