"KCNJ10" Related Products

Expand

Recombinant Human KCNJ10

Cat.No.: KCNJ10-29899TH
Product Overview: Recombinant fragment of Human Kir4.1 with N terminal proprietary tag; predicted MWt: 37.07 kDa including the tag.
Description: This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.
Protein length: 104 amino acids
Molecular Weight: 37.070kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAI SLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKL KLEESLREQAEKEGSALSVRISNV
Sequence Similarities: Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ10 subfamily.
Gene Name: KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ]
Official Symbol: KCNJ10
Synonyms: KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1;
Gene ID: 3766
mRNA Refseq: NM_002241
Protein Refseq: NP_002232
MIM: 602208
Uniprot ID: P78508
Chromosome Location: 1q23.2
Pathway: Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem;
Function: ATP binding; ATP-activated inward rectifier potassium channel activity; identical protein binding; nucleotide binding; potassium channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.