Recombinant Rat Kcnj10 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Kcnj10-538R |
| Product Overview : | Recombinant Rat Kcnj10 protein(P49655)(1-379aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-379aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.5 kDa |
| AA Sequence : | MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Kcnj10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Rattus norvegicus ] |
| Official Symbol | Kcnj10 |
| Synonyms | KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; BIR10; BIRK1; kir4.1; inward rectifier K(+) channel Kir4.1; brain-specific inwardly rectifying K(+) channel 1; ATP-sensitive inward rectifier potassium channel KAB-2; potassium channel, inwardly rectifying subfamily J member 10; |
| Gene ID | 29718 |
| mRNA Refseq | NM_031602 |
| Protein Refseq | NP_113790 |
| ◆ Recombinant Proteins | ||
| KCNJ10-3195R | Recombinant Rat KCNJ10 Protein | +Inquiry |
| KCNJ10-2381H | Recombinant Human KCNJ10 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
| KCNJ10-29899TH | Recombinant Human KCNJ10 | +Inquiry |
| KCNJ10-2851R | Recombinant Rat KCNJ10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL34278HF | Recombinant Full Length Human Atp-Sensitive Inward Rectifier Potassium Channel 10(Kcnj10) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kcnj10 Products
Required fields are marked with *
My Review for All Kcnj10 Products
Required fields are marked with *
