"KCNN3" Related Products

Expand

Recombinant Human KCNN3

Cat.No.: KCNN3-28455TH
Product Overview: Recombinant fragment corresponding to amino acids 301-410 of Human KCNN3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
Description: Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. This gene belongs to the KCNN family of potassium channels. It encodes an integral membrane protein that forms a voltage-independent calcium-activated channel, which is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. This gene contains two CAG repeat regions in the coding sequence. It was thought that expansion of one or both of these repeats could lead to an increased susceptibility to schizophrenia or bipolar disorder, but studies indicate that this is probably not the case. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITEL NDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQ QQLLSAIIEARGVSVAVGTTHTPISDSPIG
Sequence Similarities: Belongs to the potassium channel KCNN family. KCa2.3/KCNN3 subfamily.
Gene Name: KCNN3 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [ Homo sapiens ]
Official Symbol: KCNN3
Synonyms: KCNN3; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3; small conductance calcium-activated potassium channel protein 3; hSK3; KCa2.3; SKCA3;
Gene ID: 3782
mRNA Refseq: NM_001204087
Protein Refseq: NP_001191016
MIM: 602983
Uniprot ID: Q9UGI6
Chromosome Location: 1q21.3
Pathway: Ca2+ activated K+ channels, organism-specific biosystem; Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem;
Function: calmodulin binding; ion channel activity; potassium channel activity; small conductance calcium-activated potassium channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.