Recombinant Human KCNN3
Cat.No. : | KCNN3-28455TH |
Product Overview : | Recombinant fragment corresponding to amino acids 301-410 of Human KCNN3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. This gene belongs to the KCNN family of potassium channels. It encodes an integral membrane protein that forms a voltage-independent calcium-activated channel, which is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. This gene contains two CAG repeat regions in the coding sequence. It was thought that expansion of one or both of these repeats could lead to an increased susceptibility to schizophrenia or bipolar disorder, but studies indicate that this is probably not the case. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITEL NDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQ QQLLSAIIEARGVSVAVGTTHTPISDSPIG |
Sequence Similarities : | Belongs to the potassium channel KCNN family. KCa2.3/KCNN3 subfamily. |
Gene Name | KCNN3 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [ Homo sapiens ] |
Official Symbol | KCNN3 |
Synonyms | KCNN3; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3; small conductance calcium-activated potassium channel protein 3; hSK3; KCa2.3; SKCA3; |
Gene ID | 3782 |
mRNA Refseq | NM_001204087 |
Protein Refseq | NP_001191016 |
MIM | 602983 |
Uniprot ID | Q9UGI6 |
Chromosome Location | 1q21.3 |
Pathway | Ca2+ activated K+ channels, organism-specific biosystem; Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; |
Function | calmodulin binding; ion channel activity; potassium channel activity; small conductance calcium-activated potassium channel activity; |
◆ Cell & Tissue Lysates | ||
KCNN3-5021HCL | Recombinant Human KCNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNN3 Products
Required fields are marked with *
My Review for All KCNN3 Products
Required fields are marked with *
0
Inquiry Basket