Recombinant Human LALBA

Cat.No. : LALBA-27311TH
Product Overview : Recombinant fragment of Human alpha Lactalbumin with a N terminal proprietary tag; Predicted MW 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Mammary gland specific. Secreted in milk.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLF QISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAK KILDIKGIDYWLAHKALCTEKLEQWLCEKL
Sequence Similarities : Belongs to the glycosyl hydrolase 22 family.
Gene Name LALBA lactalbumin, alpha- [ Homo sapiens ]
Official Symbol LALBA
Synonyms LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7;
Gene ID 3906
mRNA Refseq NM_002289
Protein Refseq NP_002280
MIM 149750
Uniprot ID P00709
Chromosome Location 12q13
Pathway Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function calcium ion binding; lactose synthase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LALBA Products

Required fields are marked with *

My Review for All LALBA Products

Required fields are marked with *

0
cart-icon
0
compare icon