Recombinant Human LALBA
Cat.No. : | LALBA-27311TH |
Product Overview : | Recombinant fragment of Human alpha Lactalbumin with a N terminal proprietary tag; Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Mammary gland specific. Secreted in milk. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLF QISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAK KILDIKGIDYWLAHKALCTEKLEQWLCEKL |
Sequence Similarities : | Belongs to the glycosyl hydrolase 22 family. |
Gene Name : | LALBA lactalbumin, alpha- [ Homo sapiens ] |
Official Symbol : | LALBA |
Synonyms : | LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7; |
Gene ID : | 3906 |
mRNA Refseq : | NM_002289 |
Protein Refseq : | NP_002280 |
MIM : | 149750 |
Uniprot ID : | P00709 |
Chromosome Location : | 12q13 |
Pathway : | Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | calcium ion binding; lactose synthase activity; |
Products Types
◆ Recombinant Protein | ||
LALBA-3002R | Recombinant Rat LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
LALBA-3327H | Recombinant Human LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
Lalba-1288M | Recombinant Mouse Lalba Protein, MYC/DDK-tagged | +Inquiry |
LALBA-4979M | Recombinant Mouse LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
LALBA-4410H | Recombinant Human LALBA Protein (Lys20-Lys141), N-His tagged | +Inquiry |
◆ Native Protein | ||
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
◆ Lysates | ||
LALBA-4829HCL | Recombinant Human LALBA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket