Recombinant Human LALBA Protein, His-tagged

Species :	Human
Source :	HEK293
Tag :	His
Description :	THis gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
Form :	Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0
Molecular Mass :	15.1kD
AA Sequence :	KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHHH*
Endotoxin :	Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity :	>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration :	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Name	LALBA lactalbumin, alpha- [ Homo sapiens ]
Official Symbol	LALBA
Synonyms	LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7; lysozyme-like protein 7; lactose synthase B protein; MGC138521; MGC138523;
Gene ID	3906
mRNA Refseq	NM_002289
Protein Refseq	NP_002280
MIM	149750
UniProt ID	P00709