Recombinant Human LALBA Protein, His-tagged

Cat.No. : LALBA-306H
Product Overview : Recombinant Human LALBA fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : THis gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0
Molecular Mass : 15.1kD
AA Sequence : KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHHH*
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name LALBA lactalbumin, alpha- [ Homo sapiens ]
Official Symbol LALBA
Synonyms LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7; lysozyme-like protein 7; lactose synthase B protein; MGC138521; MGC138523;
Gene ID 3906
mRNA Refseq NM_002289
Protein Refseq NP_002280
MIM 149750
UniProt ID P00709

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LALBA Products

Required fields are marked with *

My Review for All LALBA Products

Required fields are marked with *

0
cart-icon