"LSP1" Related Products

Expand
Expand
Expand

Recombinant Human LSP1

Cat.No.: LSP1-29147TH
Product Overview: Recombinant fragment corresponding to amino acids 240-338 of Human LSP1 with an N terminal proprietary tag, Predicted MWt 36.52 kDa.
Description: This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Activated T-lymphocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
Gene Name: LSP1 lymphocyte-specific protein 1 [ Homo sapiens ]
Official Symbol: LSP1
Synonyms: LSP1; lymphocyte-specific protein 1; WP34;
Gene ID: 4046
mRNA Refseq: NM_001013253
Protein Refseq: NP_001013271
MIM: 153432
Uniprot ID: P33241
Chromosome Location: 11p15.5
Pathway: Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem; p38 signaling mediated by MAPKAP kinases, organism-specific biosystem;
Function: actin binding; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.