Recombinant Human LSP1

Cat.No. : LSP1-29147TH
Product Overview : Recombinant fragment corresponding to amino acids 240-338 of Human LSP1 with an N terminal proprietary tag, Predicted MWt 36.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Activated T-lymphocytes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
Gene Name LSP1 lymphocyte-specific protein 1 [ Homo sapiens ]
Official Symbol LSP1
Synonyms LSP1; lymphocyte-specific protein 1; WP34;
Gene ID 4046
mRNA Refseq NM_001013253
Protein Refseq NP_001013271
MIM 153432
Uniprot ID P33241
Chromosome Location 11p15.5
Pathway Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem; p38 signaling mediated by MAPKAP kinases, organism-specific biosystem;
Function actin binding; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSP1 Products

Required fields are marked with *

My Review for All LSP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon