Recombinant Human MAGOH, His-tagged
Cat.No. : | MAGOH-30169TH |
Product Overview : | Recombinant full length Human MAGOH with a His-Tag at C-terminus; 154aa, 18.2kDa. |
- Specification
- Gene Information
- Related Products
Description : | Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts. |
Protein length : | 146 amino acids |
Conjugation : | HIS |
Molecular Weight : | 18.200kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.03% DTT |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNY KNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPP DRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR VFYYLVQDLKCLVFSLIGLHFKIKPILEHHHHHH |
Sequence Similarities : | Belongs to the mago nashi family. |
Gene Name : | MAGOH mago-nashi homolog, proliferation-associated (Drosophila) [ Homo sapiens ] |
Official Symbol : | MAGOH |
Synonyms : | MAGOH; mago-nashi homolog, proliferation-associated (Drosophila); mago nashi (Drosophila) homolog, proliferation associated; protein mago nashi homolog; MAGOH1; MAGOHA; |
Gene ID : | 4116 |
mRNA Refseq : | NM_002370 |
Protein Refseq : | NP_002361 |
MIM : | 602603 |
Uniprot ID : | P61326 |
Chromosome Location : | 1p32.3 |
Pathway : | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function : | RNA binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
MAGOH-334H | Recombinant Human MAGOH protein(Met1-Ile146), His-tagged | +Inquiry |
MAGOH-2452R | Recombinant Rhesus Macaque MAGOH Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGOH-5303M | Recombinant Mouse MAGOH Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGOH-3201R | Recombinant Rat MAGOH Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGOH-9465M | Recombinant Mouse MAGOH Protein | +Inquiry |
◆ Lysates | ||
MAGOH-1047HCL | Recombinant Human MAGOH cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MAGOH Products
Required fields are marked with *
My Review for All MAGOH Products
Required fields are marked with *
0
Inquiry Basket