Recombinant Human MAGOH protein, GST-tagged
Cat.No. : | MAGOH-1838H |
Product Overview : | Recombinant Human MAGOH protein(1-146 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-146 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAGOH mago-nashi homolog, proliferation-associated (Drosophila) [ Homo sapiens ] |
Official Symbol | MAGOH |
Synonyms | MAGOH; mago-nashi homolog, proliferation-associated (Drosophila); mago nashi (Drosophila) homolog, proliferation associated; protein mago nashi homolog; MAGOH1; MAGOHA; |
Gene ID | 4116 |
mRNA Refseq | NM_002370 |
Protein Refseq | NP_002361 |
MIM | 602603 |
UniProt ID | P61326 |
◆ Recombinant Proteins | ||
MAGOH-7655H | Recombinant Human MAGOH protein, His-tagged | +Inquiry |
MAGOH-2458Z | Recombinant Zebrafish MAGOH | +Inquiry |
MAGOH-2452R | Recombinant Rhesus Macaque MAGOH Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGOH-9465M | Recombinant Mouse MAGOH Protein | +Inquiry |
MAGOH-30169TH | Recombinant Human MAGOH, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGOH-1047HCL | Recombinant Human MAGOH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGOH Products
Required fields are marked with *
My Review for All MAGOH Products
Required fields are marked with *
0
Inquiry Basket