Recombinant Human MAGOH protein, GST-tagged
| Cat.No. : | MAGOH-1838H |
| Product Overview : | Recombinant Human MAGOH protein(1-146 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-146 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MAGOH mago-nashi homolog, proliferation-associated (Drosophila) [ Homo sapiens ] |
| Official Symbol | MAGOH |
| Synonyms | MAGOH; mago-nashi homolog, proliferation-associated (Drosophila); mago nashi (Drosophila) homolog, proliferation associated; protein mago nashi homolog; MAGOH1; MAGOHA; |
| Gene ID | 4116 |
| mRNA Refseq | NM_002370 |
| Protein Refseq | NP_002361 |
| MIM | 602603 |
| UniProt ID | P61326 |
| ◆ Recombinant Proteins | ||
| MAGOH-2364H | Recombinant Human MAGOH, His-tagged | +Inquiry |
| MAGOH-2452R | Recombinant Rhesus Macaque MAGOH Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAGOH-30169TH | Recombinant Human MAGOH, His-tagged | +Inquiry |
| MAGOH-5303M | Recombinant Mouse MAGOH Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAGOH-1838H | Recombinant Human MAGOH protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAGOH-1047HCL | Recombinant Human MAGOH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGOH Products
Required fields are marked with *
My Review for All MAGOH Products
Required fields are marked with *
