"MAP1LC3B" Related Products

Expand
Expand
Expand

Recombinant Human MAP1LC3B

Cat.No.: MAP1LC3B-29219TH
Product Overview: Recombinant full length Human LC3B expressed in Saccharomyces cerevisiae; 125 amino acids, MWt 14.7 kDa. The protein contains a tag, increasing its size to 40 kDa.
Description: The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKG EKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQA FFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ ETFGMKLSV
Gene Name: MAP1LC3B microtubule-associated protein 1 light chain 3 beta [ Homo sapiens ]
Official Symbol: MAP1LC3B
Synonyms: MAP1LC3B; microtubule-associated protein 1 light chain 3 beta; microtubule-associated proteins 1A/1B light chain 3B; ATG8F;
Gene ID: 81631
mRNA Refseq: NM_022818
Protein Refseq: NP_073729
MIM: 609604
Uniprot ID: Q9GZQ8
Chromosome Location: 16q24.2
Pathway: Senescence and Autophagy, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.