Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MAP1LC3B

Cat.No. : MAP1LC3B-29219TH
Product Overview : Recombinant full length Human LC3B expressed in Saccharomyces cerevisiae; 125 amino acids, MWt 14.7 kDa. The protein contains a tag, increasing its size to 40 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKG EKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQA FFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ ETFGMKLSV
Gene Name : MAP1LC3B microtubule-associated protein 1 light chain 3 beta [ Homo sapiens ]
Official Symbol : MAP1LC3B
Synonyms : MAP1LC3B; microtubule-associated protein 1 light chain 3 beta; microtubule-associated proteins 1A/1B light chain 3B; ATG8F;
Gene ID : 81631
mRNA Refseq : NM_022818
Protein Refseq : NP_073729
MIM : 609604
Uniprot ID : Q9GZQ8
Chromosome Location : 16q24.2
Pathway : Senescence and Autophagy, organism-specific biosystem;
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All MAP1LC3B Products

Required fields are marked with *

My Review for All MAP1LC3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends