Recombinant Human MECR, His-tagged
Cat.No. : | MECR-27385TH |
Product Overview : | Recombinant full length Human MECR with N terminal His tag; 341 amino acids with a predicted MWt 36.9kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 320 amino acids |
Description : | MECR(Mitochondrial trans-2-enoyl-CoA reductase), also known as NRBF1, catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH dependent manner with preference to medium chain length substrate. |
Conjugation : | HIS |
Molecular Weight : | 36.900kDa inclusive of tags |
Tissue specificity : | Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM |
Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. |
Gene Name | MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens ] |
Official Symbol | MECR |
Synonyms | MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1; |
Gene ID | 51102 |
mRNA Refseq | NM_016011 |
Protein Refseq | NP_057095 |
MIM | 608205 |
Uniprot ID | Q9BV79 |
Chromosome Location | 1pter-p22.3 |
Pathway | Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, conserved biosystem; Fatty acid elongation, organism-specific biosystem; Fatty acid elongation, conserved biosystem; |
Function | nucleotide binding; oxidoreductase activity; receptor binding; trans-2-enoyl-CoA reductase (NADPH) activity; zinc ion binding; |
◆ Recombinant Proteins | ||
MECR-1824H | Recombinant Human MECR protein, GST-tagged | +Inquiry |
MECR-3290R | Recombinant Rat MECR Protein, His (Fc)-Avi-tagged | +Inquiry |
MECR-2535R | Recombinant Rhesus Macaque MECR Protein, His (Fc)-Avi-tagged | +Inquiry |
Mecr-4011M | Recombinant Mouse Mecr Protein, Myc/DDK-tagged | +Inquiry |
MECR-1825H | Recombinant Human MECR protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECR-4394HCL | Recombinant Human MECR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECR Products
Required fields are marked with *
My Review for All MECR Products
Required fields are marked with *