"MECR" Related Products

Expand
Expand

Recombinant Human MECR, His-tagged

Cat.No.: MECR-27385TH
Product Overview: Recombinant full length Human MECR with N terminal His tag; 341 amino acids with a predicted MWt 36.9kDa including tag.
Description: MECR(Mitochondrial trans-2-enoyl-CoA reductase), also known as NRBF1, catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH dependent manner with preference to medium chain length substrate.
Protein length: 320 amino acids
Conjugation: HIS
Molecular Weight: 36.900kDa inclusive of tags
Source: E. coli
Tissue specificity: Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Sequence Similarities: Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
Gene Name: MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens ]
Official Symbol: MECR
Synonyms: MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1;
Gene ID: 51102
mRNA Refseq: NM_016011
Protein Refseq: NP_057095
MIM: 608205
Uniprot ID: Q9BV79
Chromosome Location: 1pter-p22.3
Pathway: Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, conserved biosystem; Fatty acid elongation, organism-specific biosystem; Fatty acid elongation, conserved biosystem;
Function: nucleotide binding; oxidoreductase activity; receptor binding; trans-2-enoyl-CoA reductase (NADPH) activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.