Recombinant Human MECR, His-tagged

Cat.No. : MECR-27385TH
Product Overview : Recombinant full length Human MECR with N terminal His tag; 341 amino acids with a predicted MWt 36.9kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 320 amino acids
Description : MECR(Mitochondrial trans-2-enoyl-CoA reductase), also known as NRBF1, catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH dependent manner with preference to medium chain length substrate.
Conjugation : HIS
Molecular Weight : 36.900kDa inclusive of tags
Tissue specificity : Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Sequence Similarities : Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
Gene Name MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens ]
Official Symbol MECR
Synonyms MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1;
Gene ID 51102
mRNA Refseq NM_016011
Protein Refseq NP_057095
MIM 608205
Uniprot ID Q9BV79
Chromosome Location 1pter-p22.3
Pathway Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, conserved biosystem; Fatty acid elongation, organism-specific biosystem; Fatty acid elongation, conserved biosystem;
Function nucleotide binding; oxidoreductase activity; receptor binding; trans-2-enoyl-CoA reductase (NADPH) activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MECR Products

Required fields are marked with *

My Review for All MECR Products

Required fields are marked with *

0
cart-icon