Recombinant Human MECR, His-tagged

• Cat.No.: MECR-27385TH
• Product Overview: Recombinant full length Human MECR with N terminal His tag; 341 amino acids with a predicted MWt 36.9kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 320 amino acids
• Description: MECR(Mitochondrial trans-2-enoyl-CoA reductase), also known as NRBF1, catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH dependent manner with preference to medium chain length substrate.
• Conjugation: HIS
• Molecular Weight: 36.900kDa inclusive of tags
• Tissue specificity: Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
• Sequence Similarities: Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

Gene Information

• Gene Name: MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens ]
• Official Symbol: MECR
• Synonyms: MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1
• Gene ID: 51102
• mRNA Refseq: NM_016011
• Protein Refseq: NP_057095
• MIM: 608205
• Uniprot ID: Q9BV79
• Chromosome Location: 1pter-p22.3
• Pathway: Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, organism-specific biosystem; Fatty acid biosynthesis, elongation, mitochondria, conserved biosystem; Fatty acid elongation, organism-specific biosystem; Fatty acid elongation, conserved biosystem
• Function: nucleotide binding; oxidoreductase activity; receptor binding; trans-2-enoyl-CoA reductase (NADPH) activity; zinc ion binding