Recombinant Human MED4, His-tagged

• Cat.No.: MED4-29557TH
• Product Overview: Recombinant fragment, corresponding to amino acids 24-270 of Human MED4 with an N-terminal His tag; Predicted MWt 29 kDa.

Specification

• Description: The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 94 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEEN QVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVE KRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKAR KGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYP TDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLA PQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDV EIMSTDSSSSSSESD
• Sequence Similarities: Belongs to the Mediator complex subunit 4 family.

Gene Information

• Gene Name: MED4 mediator complex subunit 4 [ Homo sapiens ]
• Official Symbol: MED4
• Synonyms: MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36
• Gene ID: 29079
• mRNA Refseq: NM_014166
• Protein Refseq: NP_054885
• MIM: 605718
• Uniprot ID: Q9NPJ6
• Chromosome Location: 13q14.12
• Pathway: Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem
• Function: RNA polymerase II transcription cofactor activity; RNA polymerase II transcription cofactor activity; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; receptor activity