"MED4" Related Products

Expand
Expand

Recombinant Human MED4, His-tagged

Cat.No.: MED4-29557TH
Product Overview: Recombinant fragment, corresponding to amino acids 24-270 of Human MED4 with an N-terminal His tag; Predicted MWt 29 kDa.
Description: The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 94 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEEN QVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVE KRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKAR KGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYP TDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLA PQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDV EIMSTDSSSSSSESD
Sequence Similarities: Belongs to the Mediator complex subunit 4 family.
Gene Name: MED4 mediator complex subunit 4 [ Homo sapiens ]
Official Symbol: MED4
Synonyms: MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36;
Gene ID: 29079
mRNA Refseq: NM_014166
Protein Refseq: NP_054885
MIM: 605718
Uniprot ID: Q9NPJ6
Chromosome Location: 13q14.12
Pathway: Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem;
Function: RNA polymerase II transcription cofactor activity; RNA polymerase II transcription cofactor activity; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.