Recombinant Human MEIS1

• Cat.No.: MEIS1-29559TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-90 of Human MEIS1 with a proprietary tag; Predicted MWt 35.53 kDa including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins.
• Molecular Weight: 35.530kDa inclusive of tags
• Tissue specificity: Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high leve
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI
• Sequence Similarities: Belongs to the TALE/MEIS homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: MEIS1 Meis homeobox 1 [ Homo sapiens ]
• Official Symbol: MEIS1
• Synonyms: MEIS1; Meis homeobox 1; Meis1 (mouse) homolog , Meis1, myeloid ecotropic viral integration site 1 homolog (mouse); homeobox protein Meis1
• Gene ID: 4211
• mRNA Refseq: NM_002398
• Protein Refseq: NP_002389
• MIM: 601739
• Uniprot ID: O00470
• Chromosome Location: 2p14
• Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: protein binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity