Recombinant Human MEIS1
Cat.No. : | MEIS1-29559TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-90 of Human MEIS1 with a proprietary tag; Predicted MWt 35.53 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. |
Molecular Weight : | 35.530kDa inclusive of tags |
Tissue specificity : | Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high leve |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI |
Sequence Similarities : | Belongs to the TALE/MEIS homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | MEIS1 Meis homeobox 1 [ Homo sapiens ] |
Official Symbol | MEIS1 |
Synonyms | MEIS1; Meis homeobox 1; Meis1 (mouse) homolog , Meis1, myeloid ecotropic viral integration site 1 homolog (mouse); homeobox protein Meis1; |
Gene ID | 4211 |
mRNA Refseq | NM_002398 |
Protein Refseq | NP_002389 |
MIM | 601739 |
Uniprot ID | O00470 |
Chromosome Location | 2p14 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | protein binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
◆ Recombinant Proteins | ||
MEIS1-26868TH | Recombinant Human MEIS1 protein, GST-tagged | +Inquiry |
MEIS1-4532H | Recombinant Human MEIS1 Protein (Asp200-Met334), N-His tagged | +Inquiry |
MEIS1-3886C | Recombinant Chicken MEIS1 | +Inquiry |
MEIS1-29559TH | Recombinant Human MEIS1 | +Inquiry |
MEIS1-5470M | Recombinant Mouse MEIS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEIS1-4373HCL | Recombinant Human MEIS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIS1 Products
Required fields are marked with *
My Review for All MEIS1 Products
Required fields are marked with *