"MEIS1" Related Products

Recombinant Human MEIS1

Cat.No.: MEIS1-29559TH
Product Overview: Recombinant fragment corresponding to amino acids 1-90 of Human MEIS1 with a proprietary tag; Predicted MWt 35.53 kDa including tag.
Description: Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high leve
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI
Sequence Similarities: Belongs to the TALE/MEIS homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: MEIS1 Meis homeobox 1 [ Homo sapiens ]
Official Symbol: MEIS1
Synonyms: MEIS1; Meis homeobox 1; Meis1 (mouse) homolog , Meis1, myeloid ecotropic viral integration site 1 homolog (mouse); homeobox protein Meis1;
Gene ID: 4211
mRNA Refseq: NM_002398
Protein Refseq: NP_002389
MIM: 601739
Uniprot ID: O00470
Chromosome Location: 2p14
Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: protein binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.