Recombinant Human MEIS1
| Cat.No. : | MEIS1-29559TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 1-90 of Human MEIS1 with a proprietary tag; Predicted MWt 35.53 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Tissue specificity : | Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high leve |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI |
| Sequence Similarities : | Belongs to the TALE/MEIS homeobox family.Contains 1 homeobox DNA-binding domain. |
| Gene Name | MEIS1 Meis homeobox 1 [ Homo sapiens ] |
| Official Symbol | MEIS1 |
| Synonyms | MEIS1; Meis homeobox 1; Meis1 (mouse) homolog , Meis1, myeloid ecotropic viral integration site 1 homolog (mouse); homeobox protein Meis1; |
| Gene ID | 4211 |
| mRNA Refseq | NM_002398 |
| Protein Refseq | NP_002389 |
| MIM | 601739 |
| Uniprot ID | O00470 |
| Chromosome Location | 2p14 |
| Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
| Function | protein binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
| ◆ Recombinant Proteins | ||
| MEIS1-26868TH | Recombinant Human MEIS1 protein, GST-tagged | +Inquiry |
| MEIS1-5470M | Recombinant Mouse MEIS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MEIS1-9722M | Recombinant Mouse MEIS1 Protein | +Inquiry |
| MEIS1-29559TH | Recombinant Human MEIS1 | +Inquiry |
| MEIS1-3886C | Recombinant Chicken MEIS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MEIS1-4373HCL | Recombinant Human MEIS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIS1 Products
Required fields are marked with *
My Review for All MEIS1 Products
Required fields are marked with *
