Recombinant Human MEIS1

Cat.No. : MEIS1-29559TH
Product Overview : Recombinant fragment corresponding to amino acids 1-90 of Human MEIS1 with a proprietary tag; Predicted MWt 35.53 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high leve
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI
Sequence Similarities : Belongs to the TALE/MEIS homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name MEIS1 Meis homeobox 1 [ Homo sapiens ]
Official Symbol MEIS1
Synonyms MEIS1; Meis homeobox 1; Meis1 (mouse) homolog , Meis1, myeloid ecotropic viral integration site 1 homolog (mouse); homeobox protein Meis1;
Gene ID 4211
mRNA Refseq NM_002398
Protein Refseq NP_002389
MIM 601739
Uniprot ID O00470
Chromosome Location 2p14
Pathway Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function protein binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MEIS1 Products

Required fields are marked with *

My Review for All MEIS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon