Recombinant Human MOB1A, His-tagged

Cat.No. : MOB1A-28177TH
Product Overview : Recombinant full length Human MOBK1B with an N terminal His tag; 236 amino acids with tag, Predicted MWt 27.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 216 amino acids
Conjugation : HIS
Molecular Weight : 27.200kDa inclusive of tags
Tissue specificity : Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
Sequence Similarities : Belongs to the MOB1/phocein family.
Gene Name MOB1A MOB kinase activator 1A [ Homo sapiens ]
Official Symbol MOB1A
Synonyms MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6 , MOB1 Mps One Binder homolog A (yeast) , MOB1, Mps One Binder kinase activator like 1B (yeast) , MOBK1B, MOBKL1B; mps one binder kinase activator-like 1B; FLJ10788; FLJ11595; Ma
Gene ID 55233
mRNA Refseq NM_018221
Protein Refseq NP_060691
MIM 609281
Uniprot ID Q9H8S9
Chromosome Location 2p13.1
Function metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOB1A Products

Required fields are marked with *

My Review for All MOB1A Products

Required fields are marked with *

0
cart-icon