Recombinant Human MOB1A, His-tagged

• Cat.No.: MOB1A-28177TH
• Product Overview: Recombinant full length Human MOBK1B with an N terminal His tag; 236 amino acids with tag, Predicted MWt 27.2 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 216 amino acids
• Conjugation: HIS
• Molecular Weight: 27.200kDa inclusive of tags
• Tissue specificity: Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
• Sequence Similarities: Belongs to the MOB1/phocein family.

Gene Information

• Gene Name: MOB1A MOB kinase activator 1A [ Homo sapiens ]
• Official Symbol: MOB1A
• Synonyms: MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6 , MOB1 Mps One Binder homolog A (yeast) , MOB1, Mps One Binder kinase activator like 1B (yeast) , MOBK1B, MOBKL1B; mps one binder kinase activator-like 1B; FLJ10788; FLJ11595; Ma
• Gene ID: 55233
• mRNA Refseq: NM_018221
• Protein Refseq: NP_060691
• MIM: 609281
• Uniprot ID: Q9H8S9
• Chromosome Location: 2p13.1
• Function: metal ion binding; protein binding