Recombinant Full Length Human MOB1A Protein, GST-tagged
Cat.No. : | MOB1A-6292HF |
Product Overview : | Human MOBKL1B full-length ORF ( AAH03398.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 216 amino acids |
Description : | The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOB1A MOB kinase activator 1A [ Homo sapiens (human) ] |
Official Symbol | MOB1A |
Synonyms | MOB1A; MOB kinase activator 1A; MOB1; MATS1; Mob4B; C2orf6; MOBK1B; MOBKL1B; MOB kinase activator 1A; MOB1 Mps One Binder homolog A; MOB1, Mps One Binder kinase activator-like 1B; mob1 alpha; mob1 homolog 1B; mps one binder kinase activator-like 1B |
Gene ID | 55233 |
mRNA Refseq | NM_001317110 |
Protein Refseq | NP_001304039 |
MIM | 609281 |
UniProt ID | Q9H8S9 |
◆ Recombinant Proteins | ||
MOB1A-5455H | Recombinant Human MOB1A Protein, GST-tagged | +Inquiry |
MOB1A-28178TH | Recombinant Human MOB1A | +Inquiry |
MOB1A-28177TH | Recombinant Human MOB1A, His-tagged | +Inquiry |
MOB1A-10283Z | Recombinant Zebrafish MOB1A | +Inquiry |
Mob1a-4104M | Recombinant Mouse Mob1a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOB1A-413HCL | Recombinant Human MOB1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB1A Products
Required fields are marked with *
My Review for All MOB1A Products
Required fields are marked with *