| Description : |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms. |
| Conjugation : |
HIS |
| Source : |
E. coli |
| Form : |
Lyophilised:Reconstitute with 164 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQL QDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGK KFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFR NAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGP GRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL |
| Sequence Similarities : |
Belongs to the ribosomal protein S11P family. |
