Recombinant Human MRPS11, His-tagged
Cat.No. : | MRPS11-28172TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-194 of Human MRPS11 with N terminal His tag, 26kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-194 a.a. |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 164 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQL QDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGK KFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFR NAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGP GRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL |
Sequence Similarities : | Belongs to the ribosomal protein S11P family. |
Full Length : | Full L. |
Gene Name | MRPS11 mitochondrial ribosomal protein S11 [ Homo sapiens ] |
Official Symbol | MRPS11 |
Synonyms | MRPS11; mitochondrial ribosomal protein S11; 28S ribosomal protein S11, mitochondrial; cervical cancer proto oncogene 2; FLJ22512; FLJ23406; HCC 2; |
Gene ID | 64963 |
mRNA Refseq | NM_176805 |
Protein Refseq | NP_789775 |
MIM | 611977 |
Uniprot ID | P82912 |
Chromosome Location | 15q25 |
Function | structural constituent of ribosome; |
◆ Recombinant Proteins | ||
MRPS11-6455HF | Recombinant Full Length Human MRPS11 Protein, GST-tagged | +Inquiry |
MRPS11-2854R | Recombinant Rhesus monkey MRPS11 Protein, His-tagged | +Inquiry |
MRPS11-2674R | Recombinant Rhesus Macaque MRPS11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS11-1261C | Recombinant Chicken MRPS11 | +Inquiry |
MRPS11-28172TH | Recombinant Human MRPS11, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS11-4153HCL | Recombinant Human MRPS11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS11 Products
Required fields are marked with *
My Review for All MRPS11 Products
Required fields are marked with *
0
Inquiry Basket