Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MRPS11, His-tagged

Cat.No. : MRPS11-28172TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-194 of Human MRPS11 with N terminal His tag, 26kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 164 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQL QDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGK KFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFR NAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGP GRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
Sequence Similarities : Belongs to the ribosomal protein S11P family.
Gene Name : MRPS11 mitochondrial ribosomal protein S11 [ Homo sapiens ]
Official Symbol : MRPS11
Synonyms : MRPS11; mitochondrial ribosomal protein S11; 28S ribosomal protein S11, mitochondrial; cervical cancer proto oncogene 2; FLJ22512; FLJ23406; HCC 2;
Gene ID : 64963
mRNA Refseq : NM_176805
Protein Refseq : NP_789775
MIM : 611977
Uniprot ID : P82912
Chromosome Location : 15q25
Function : structural constituent of ribosome;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends