"NELL1" Related Products

Expand

Recombinant Human NELL1

Cat.No.: NELL1-29226TH
Product Overview: Recombinant fragment of Human NELL1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
Sequence Similarities: Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains.
Gene Name: NELL1 NEL-like 1 (chicken) [ Homo sapiens ]
Official Symbol: NELL1
Synonyms: NELL1; NEL-like 1 (chicken); nel (chicken) like 1; protein kinase C-binding protein NELL1; FLJ45906; IDH3GL;
Gene ID: 4745
mRNA Refseq: NM_006157
Protein Refseq: NP_006148
MIM: 602319
Uniprot ID: Q92832
Chromosome Location: 11p15.1
Function: calcium ion binding; protein kinase C binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.