"NME4" Related Products

Expand
Expand
Expand

Recombinant Human NME4, His-tagged

Cat.No.: NME4-28746TH
Product Overview: Recombinant full length Human mature NME4 with an N terminal His tag; 176 amino acids, predicted MWt 19.6kDa.
Description: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al.
Protein length: 155 amino acids
Conjugation: HIS
Molecular Weight: 19.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Sequence Similarities: Belongs to the NDK family.
Gene Name: NME4 non-metastatic cells 4, protein expressed in [ Homo sapiens ]
Official Symbol: NME4
Synonyms: NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4;
Gene ID: 4833
mRNA Refseq: NM_005009
Protein Refseq: NP_005000
MIM: 601818
Uniprot ID: O00746
Chromosome Location: 16p13.3
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem;
Function: ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleoside diphosphate kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.