Recombinant Human NME4, His-tagged

Cat.No. : NME4-28746TH
Product Overview : Recombinant full length Human mature NME4 with an N terminal His tag; 176 amino acids, predicted MWt 19.6kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 155 amino acids
Description : The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al.
Conjugation : HIS
Molecular Weight : 19.600kDa inclusive of tags
Tissue specificity : Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Sequence Similarities : Belongs to the NDK family.
Gene Name NME4 non-metastatic cells 4, protein expressed in [ Homo sapiens ]
Official Symbol NME4
Synonyms NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4;
Gene ID 4833
mRNA Refseq NM_005009
Protein Refseq NP_005000
MIM 601818
Uniprot ID O00746
Chromosome Location 16p13.3
Pathway Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem;
Function ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleoside diphosphate kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME4 Products

Required fields are marked with *

My Review for All NME4 Products

Required fields are marked with *

0
cart-icon