Recombinant Human NME4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NME4-5453H
Product Overview : NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4.
Molecular Mass : 20.7 kDa
AA Sequence : MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NME4 NME/NM23 nucleoside diphosphate kinase 4 [ Homo sapiens (human) ]
Official Symbol NME4
Synonyms NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; NDPK-D; nm23-H4;
Gene ID 4833
mRNA Refseq NM_005009
Protein Refseq NP_005000
MIM 601818
UniProt ID O00746

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME4 Products

Required fields are marked with *

My Review for All NME4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon