Recombinant Human NME4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NME4-5453H |
Product Overview : | NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4. |
Molecular Mass : | 20.7 kDa |
AA Sequence : | MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NME4 NME/NM23 nucleoside diphosphate kinase 4 [ Homo sapiens (human) ] |
Official Symbol | NME4 |
Synonyms | NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; NDPK-D; nm23-H4; |
Gene ID | 4833 |
mRNA Refseq | NM_005009 |
Protein Refseq | NP_005000 |
MIM | 601818 |
UniProt ID | O00746 |
◆ Recombinant Proteins | ||
NME4-5453H | Recombinant Human NME4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NME4-196H | Active Recombinant Human NME4 protein, His-tagged | +Inquiry |
NME4-6578HF | Recombinant Full Length Human NME4 Protein, GST-tagged | +Inquiry |
NME4-2875R | Recombinant Rhesus Macaque NME4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nme4-4437M | Recombinant Mouse Nme4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME4-3789HCL | Recombinant Human NME4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME4 Products
Required fields are marked with *
My Review for All NME4 Products
Required fields are marked with *