Recombinant Human NOX4

Cat.No. : NOX4-29711TH
Product Overview : Recombinant fragment corresponding to aa 479-578 of human NOX4 with a proprietary tag; 36.63kDa inclusive of tag;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain t
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Sequence Similarities : Contains 1 FAD-binding FR-type domain.Contains 1 ferric oxidoreductase domain.
Gene Name NOX4 NADPH oxidase 4 [ Homo sapiens ]
Official Symbol NOX4
Synonyms NOX4; NADPH oxidase 4; KOX; KOX 1;
Gene ID 50507
mRNA Refseq NM_001143836
Protein Refseq NP_001137308
MIM 605261
Uniprot ID Q9NPH5
Chromosome Location 11q14.2-q21
Pathway Oxidative Stress, organism-specific biosystem; Signaling events mediated by PTP1B, organism-specific biosystem;
Function NAD(P)H oxidase activity; electron carrier activity; flavin adenine dinucleotide binding; heme binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOX4 Products

Required fields are marked with *

My Review for All NOX4 Products

Required fields are marked with *

0
cart-icon