Recombinant Human NPR1

Cat.No. : NPR1-28546TH
Product Overview : Recombinant fragment of Human Natriuretic Peptide Receptor A with a proprietary tag; predicted MWt 36.74 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994
Molecular Weight : 36.740kDa inclusive of tags
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS
Sequence Similarities : Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.Contains 1 guanylate cyclase domain.Contains 1 protein kinase domain.
Gene Name NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) [ Homo sapiens ]
Official Symbol NPR1
Synonyms NPR1; natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A); ANPRA, NPRA; atrial natriuretic peptide receptor 1; ANPa; GUCY2A;
Gene ID 4881
mRNA Refseq NM_000906
Protein Refseq NP_000897
MIM 108960
Uniprot ID P16066
Chromosome Location 1q21-q22
Pathway Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem;
Function ATP binding; G-protein coupled peptide receptor activity; GTP binding; guanylate cyclase activity; hormone binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPR1 Products

Required fields are marked with *

My Review for All NPR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon