Recombinant Human NPR1 Protein, GST-tagged
Cat.No. : | NPR1-6043H |
Product Overview : | Human NPR1 partial ORF ( AAH63304, 147 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively).[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) [ Homo sapiens ] |
Official Symbol | NPR1 |
Synonyms | NPR1; natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A); ANPRA, NPRA; atrial natriuretic peptide receptor 1; ANPa; GUCY2A; GC-A; ANP-A; NPR-A; ANPR-A; guanylate cyclase A; natriuretic peptide receptor A; atrionatriuretic peptide receptor A; natriuretic peptide A type receptor; atrial natriuretic peptide receptor type A; NPRA; ANPRA; GUC2A; |
Gene ID | 4881 |
mRNA Refseq | NM_000906 |
Protein Refseq | NP_000897 |
MIM | 108960 |
UniProt ID | P16066 |
◆ Recombinant Proteins | ||
NPR1-2503H | Recombinant Human NPR1 Protein, His-tagged | +Inquiry |
NPR1-1299H | Recombinant Human NPR1 Protein, His-tagged | +Inquiry |
NPR1-1476H | Recombinant Human NPR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPR1-4049R | Recombinant Rat NPR1 Protein | +Inquiry |
NPR1-0538H | Recombinant Human NPR1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPR1-3733HCL | Recombinant Human NPR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPR1 Products
Required fields are marked with *
My Review for All NPR1 Products
Required fields are marked with *