Recombinant Human OAS1, His-tagged
Cat.No. : | OAS1-27767TH |
Product Overview : | Recombinant full length Human OAS1, isoform p41 with N terminal His tag; 384 amino acids with a predicted MWt 43.9kDa including tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2-specific nucleotidyl transfer reactions to synthesize 2,5-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein length : | 364 amino acids |
Conjugation : | HIS |
Molecular Weight : | 43.900kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMMDLRNTPAKSLDKFIEDYL LPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQ EIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ LGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDL QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCK KKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLE LVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPV SSWILLVRPPASSLPFIPAPLHEA |
Sequence Similarities : | Belongs to the 2-5A synthase family. |
Gene Name : | OAS1 2-5-oligoadenylate synthetase 1, 40/46kDa [ Homo sapiens ] |
Official Symbol : | OAS1 |
Synonyms : | OAS1; 2-5-oligoadenylate synthetase 1, 40/46kDa; 2,5 oligoadenylate synthetase 1 (40 46 kD) , OIAS; 2-5-oligoadenylate synthase 1; IFI 4; OIASI; |
Gene ID : | 4938 |
mRNA Refseq : | NM_001032409 |
Protein Refseq : | NP_001027581 |
Uniprot ID : | P00973 |
Chromosome Location : | 12q24.2 |
Pathway : | Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function : | 2-5-oligoadenylate synthetase activity; ATP binding; double-stranded RNA binding; nucleotide binding; nucleotidyltransferase activity; |
Products Types
◆ Recombinant Protein | ||
OAS1-2966R | Recombinant Rhesus Macaque OAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OAS1-123R | Recombinant Rat OAS1 protein, His-T7-tagged | +Inquiry |
OAS1-378H | Recombinant Human 2,5-oligoadenylate Synthetase 1, 40/46kDa | +Inquiry |
OAS1-3148R | Recombinant Rhesus monkey OAS1 Protein, His-tagged | +Inquiry |
OAS1-121M | Recombinant Mouse OAS1 protein, His-TRxA-tagged | +Inquiry |
◆ Lysates | ||
OAS1-3615HCL | Recombinant Human OAS1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket