"OAS1" Related Products

Expand

Recombinant Human OAS1, His-tagged

Cat.No.: OAS1-27767TH
Product Overview: Recombinant full length Human OAS1, isoform p41 with N terminal His tag; 384 amino acids with a predicted MWt 43.9kDa including tag.
Description: This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2-specific nucleotidyl transfer reactions to synthesize 2,5-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein length: 364 amino acids
Conjugation: HIS
Molecular Weight: 43.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMMDLRNTPAKSLDKFIEDYL LPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQ EIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ LGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDL QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCK KKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLE LVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPV SSWILLVRPPASSLPFIPAPLHEA
Sequence Similarities: Belongs to the 2-5A synthase family.
Gene Name: OAS1 2-5-oligoadenylate synthetase 1, 40/46kDa [ Homo sapiens ]
Official Symbol: OAS1
Synonyms: OAS1; 2-5-oligoadenylate synthetase 1, 40/46kDa; 2,5 oligoadenylate synthetase 1 (40 46 kD) , OIAS; 2-5-oligoadenylate synthase 1; IFI 4; OIASI;
Gene ID: 4938
mRNA Refseq: NM_001032409
Protein Refseq: NP_001027581
Uniprot ID: P00973
Chromosome Location: 12q24.2
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function: 2-5-oligoadenylate synthetase activity; ATP binding; double-stranded RNA binding; nucleotide binding; nucleotidyltransferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.