Recombinant Human OAS1 protein, GST-tagged

• Cat.No.: OAS1-3731H
• Product Overview: Recombinant Human OAS1 protein(1-351 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-351 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: OAS1 2-5-oligoadenylate synthetase 1, 40/46kDa [ Homo sapiens ]
• Official Symbol: OAS1
• Synonyms: OAS1; 2-5-oligoadenylate synthetase 1, 40/46kDa; 2,5 oligoadenylate synthetase 1 (40 46 kD) , OIAS; 2-5-oligoadenylate synthase 1; IFI 4; OIASI; E18/E16; p46/p42 OAS; 2-5A synthase 1; 2-5A synthetase 1; (2-5)oligo(A) synthase 1; 2,5-oligo A synthetase 1; (2-5)oligo(A) synthetase 1; 2-5-oligoisoadenylate synthetase 1; 2,5-oligoadenylate synthetase 1, 40/46kDa; 2-5 oligoadenylate synthetase 1 p48 isoform; 2-5 oligoadenylate synthetase 1 p52 isoform; OIAS; IFI-4
• Gene ID: 4938
• mRNA Refseq: NM_001032409
• Protein Refseq: NP_001027581
• UniProt ID: P00973