Recombinant Human OAS1 protein, GST-tagged

Cat.No. : OAS1-3731H
Product Overview : Recombinant Human OAS1 protein(1-351 aa), fused to GST tag, was expressed in E. coli.
Availability July 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-351 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name OAS1 2-5-oligoadenylate synthetase 1, 40/46kDa [ Homo sapiens ]
Official Symbol OAS1
Synonyms OAS1; 2-5-oligoadenylate synthetase 1, 40/46kDa; 2,5 oligoadenylate synthetase 1 (40 46 kD) , OIAS; 2-5-oligoadenylate synthase 1; IFI 4; OIASI; E18/E16; p46/p42 OAS; 2-5A synthase 1; 2-5A synthetase 1; (2-5)oligo(A) synthase 1; 2,5-oligo A synthetase 1; (2-5)oligo(A) synthetase 1; 2-5-oligoisoadenylate synthetase 1; 2,5-oligoadenylate synthetase 1, 40/46kDa; 2-5 oligoadenylate synthetase 1 p48 isoform; 2-5 oligoadenylate synthetase 1 p52 isoform; OIAS; IFI-4;
Gene ID 4938
mRNA Refseq NM_001032409
Protein Refseq NP_001027581
UniProt ID P00973

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OAS1 Products

Required fields are marked with *

My Review for All OAS1 Products

Required fields are marked with *

0
cart-icon