Recombinant Human OAS1 protein, GST-tagged
Cat.No. : | OAS1-3731H |
Product Overview : | Recombinant Human OAS1 protein(1-351 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-351 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | OAS1 2-5-oligoadenylate synthetase 1, 40/46kDa [ Homo sapiens ] |
Official Symbol | OAS1 |
Synonyms | OAS1; 2-5-oligoadenylate synthetase 1, 40/46kDa; 2,5 oligoadenylate synthetase 1 (40 46 kD) , OIAS; 2-5-oligoadenylate synthase 1; IFI 4; OIASI; E18/E16; p46/p42 OAS; 2-5A synthase 1; 2-5A synthetase 1; (2-5)oligo(A) synthase 1; 2,5-oligo A synthetase 1; (2-5)oligo(A) synthetase 1; 2-5-oligoisoadenylate synthetase 1; 2,5-oligoadenylate synthetase 1, 40/46kDa; 2-5 oligoadenylate synthetase 1 p48 isoform; 2-5 oligoadenylate synthetase 1 p52 isoform; OIAS; IFI-4; |
Gene ID | 4938 |
mRNA Refseq | NM_001032409 |
Protein Refseq | NP_001027581 |
UniProt ID | P00973 |
◆ Recombinant Proteins | ||
OAS1-122M | Recombinant Mouse OAS1 protein, His-SUMO-tagged | +Inquiry |
OAS1-2966R | Recombinant Rhesus Macaque OAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OAS1-27767TH | Recombinant Human OAS1, His-tagged | +Inquiry |
OAS1-378H | Recombinant Human 2,5-oligoadenylate Synthetase 1, 40/46kDa | +Inquiry |
OAS1-123R | Recombinant Rat OAS1 protein, His-T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OAS1-3615HCL | Recombinant Human OAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OAS1 Products
Required fields are marked with *
My Review for All OAS1 Products
Required fields are marked with *