Recombinant Human OMP
Cat.No. : | OMP-26853TH |
Product Overview : | Recombinant fragment corresponding to amino acids 65-163 of Human Olfactory Marker Protein with N terminal proprietary tag; Predicted MWt 36.52. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man.The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL |
Gene Name | OMP olfactory marker protein [ Homo sapiens ] |
Official Symbol | OMP |
Synonyms | OMP; olfactory marker protein; |
Gene ID | 4975 |
mRNA Refseq | NM_006189 |
Protein Refseq | NP_006180 |
MIM | 164340 |
Uniprot ID | P47874 |
Chromosome Location | 11q14-q21 |
Function | signal transducer activity; |
◆ Recombinant Proteins | ||
OMP-2115R | Recombinant Rickettsia Japonica OMP Protein (20-159 aa), His-SUMO-tagged | +Inquiry |
OMP-4185R | Recombinant Rat OMP Protein | +Inquiry |
omp-1278R | Recombinant Rickettsia rickettsii omp protein, His&Myc-tagged | +Inquiry |
OMP-1457H | Recombinant Human OMP, GST-tagged | +Inquiry |
omp-4151R | Recombinant Rickettsia rickettsii omp protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OMP-1250HCL | Recombinant Human OMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OMP Products
Required fields are marked with *
My Review for All OMP Products
Required fields are marked with *