Recombinant Human OMP

Cat.No. : OMP-26853TH
Product Overview : Recombinant fragment corresponding to amino acids 65-163 of Human Olfactory Marker Protein with N terminal proprietary tag; Predicted MWt 36.52.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man.The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
Gene Name OMP olfactory marker protein [ Homo sapiens ]
Official Symbol OMP
Synonyms OMP; olfactory marker protein;
Gene ID 4975
mRNA Refseq NM_006189
Protein Refseq NP_006180
MIM 164340
Uniprot ID P47874
Chromosome Location 11q14-q21
Function signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OMP Products

Required fields are marked with *

My Review for All OMP Products

Required fields are marked with *

0
cart-icon
0
compare icon