Recombinant Human OMP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OMP-4462H
Product Overview : OMP MS Standard C13 and N15-labeled recombinant protein (NP_006180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade.
Molecular Mass : 18.8 kDa
AA Sequence : MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQLSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OMP olfactory marker protein [ Homo sapiens (human) ]
Official Symbol OMP
Synonyms OMP; olfactory marker protein; olfactory neuronal-specific protein;
Gene ID 4975
mRNA Refseq NM_006189
Protein Refseq NP_006180
MIM 164340
UniProt ID P47874

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OMP Products

Required fields are marked with *

My Review for All OMP Products

Required fields are marked with *

0
cart-icon