"OVGP1" Related Products

Expand
Expand

Recombinant Human OVGP1

Cat.No.: OVGP1-30528TH
Product Overview: Recombinant fragment of Human OVGP1 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.
Description: This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Oviduct.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE
Sequence Similarities: Belongs to the glycosyl hydrolase 18 family.
Gene Name: OVGP1 oviductal glycoprotein 1, 120kDa [ Homo sapiens ]
Official Symbol: OVGP1
Synonyms: OVGP1; oviductal glycoprotein 1, 120kDa; MUC9, mucin 9; oviduct-specific glycoprotein; CHIT5; oviductin;
Gene ID: 5016
mRNA Refseq: NM_002557
Protein Refseq: NP_002548
MIM: 603578
Uniprot ID: Q12889
Chromosome Location: 1p13.2
Function: catalytic activity; cation binding; chitinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.