Recombinant Human OVGP1

Cat.No. : OVGP1-30528TH
Product Overview : Recombinant fragment of Human OVGP1 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Oviduct.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE
Sequence Similarities : Belongs to the glycosyl hydrolase 18 family.
Gene Name OVGP1 oviductal glycoprotein 1, 120kDa [ Homo sapiens ]
Official Symbol OVGP1
Synonyms OVGP1; oviductal glycoprotein 1, 120kDa; MUC9, mucin 9; oviduct-specific glycoprotein; CHIT5; oviductin;
Gene ID 5016
mRNA Refseq NM_002557
Protein Refseq NP_002548
MIM 603578
Uniprot ID Q12889
Chromosome Location 1p13.2
Function catalytic activity; cation binding; chitinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OVGP1 Products

Required fields are marked with *

My Review for All OVGP1 Products

Required fields are marked with *

0
cart-icon