Recombinant Human OVGP1
Cat.No. : | OVGP1-30528TH |
Product Overview : | Recombinant fragment of Human OVGP1 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Oviduct. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE |
Sequence Similarities : | Belongs to the glycosyl hydrolase 18 family. |
Gene Name | OVGP1 oviductal glycoprotein 1, 120kDa [ Homo sapiens ] |
Official Symbol | OVGP1 |
Synonyms | OVGP1; oviductal glycoprotein 1, 120kDa; MUC9, mucin 9; oviduct-specific glycoprotein; CHIT5; oviductin; |
Gene ID | 5016 |
mRNA Refseq | NM_002557 |
Protein Refseq | NP_002548 |
MIM | 603578 |
Uniprot ID | Q12889 |
Chromosome Location | 1p13.2 |
Function | catalytic activity; cation binding; chitinase activity; |
◆ Recombinant Proteins | ||
OVGP1-3263R | Recombinant Rhesus monkey OVGP1 Protein, His-tagged | +Inquiry |
OVGP1-1593H | Recombinant Human OVGP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OVGP1-1014HFL | Recombinant Full Length Human OVGP1 Protein, C-Flag-tagged | +Inquiry |
OVGP1-3081R | Recombinant Rhesus Macaque OVGP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ovgp1-8010M | Recombinant Mouse Ovgp1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVGP1-3509HCL | Recombinant Human OVGP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OVGP1 Products
Required fields are marked with *
My Review for All OVGP1 Products
Required fields are marked with *