Recombinant Human PEBP1, His-tagged
Cat.No. : | PEBP1-30792TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-187 of Human PBP with N terminal His tag; Predicted MWt 22 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Phosphatidylethanolamine-binding protein 1 is a protein that in humans is encoded by the PEBP1 gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 106 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKV LTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKD PKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTG LHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASF RKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK |
Sequence Similarities : | Belongs to the phosphatidylethanolamine-binding protein family. |
Gene Name : | PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens ] |
Official Symbol : | PEBP1 |
Synonyms : | PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP; |
Gene ID : | 5037 |
mRNA Refseq : | NM_002567 |
Protein Refseq : | NP_002558 |
MIM : | 604591 |
Uniprot ID : | P30086 |
Chromosome Location : | 12q24 |
Pathway : | Aurora B signaling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function : | ATP binding; lipid binding; mitogen-activated protein kinase binding; nucleotide binding; peptidase inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
PEBP1-6627M | Recombinant Mouse PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pebp1-520M | Recombinant Mouse Pebp1 Protein, His-tagged | +Inquiry |
PEBP1-3186R | Recombinant Rhesus Macaque PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pebp1-4787M | Recombinant Mouse Pebp1 Protein, Myc/DDK-tagged | +Inquiry |
PEBP1-4028R | Recombinant Rat PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
PEBP1-3311HCL | Recombinant Human PEBP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket